PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR05G14380.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 192aa    MW: 21340.7 Da    PI: 8.2728
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR05G14380.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.91.3e-092270147
                     TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqky 47
                     r +WT+ Ed+ +  a   ++ +   +W+++a++++ gR++ ++ +++q +
  LPERR05G14380.1 22 RRPWTKAEDKVFESALVAFPEHtqnRWALVASHLP-GRSAQEVWEHFQVL 70
                     679****************999999**********.***********975 PP

2Myb_DNA-binding45.12.2e-14124168347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++++ +++G g+W+ I+r   k+Rt+ q+ s+ qk+
  LPERR05G14380.1 124 PWTEEEHRLFLEGLEKYGRGDWRNISRWSVKTRTPTQVASHAQKF 168
                      8******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007176.9E-82173IPR001005SANT/Myb domain
PROSITE profilePS512948.3072175IPR017930Myb domain
PfamPF002496.2E-82269IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-82271IPR009057Homeodomain-like
SuperFamilySSF466895.73E-122377IPR009057Homeodomain-like
CDDcd001677.50E-72470No hitNo description
PROSITE profilePS5129419.617117173IPR017930Myb domain
SuperFamilySSF466895.8E-18119173IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-16121172IPR006447Myb domain, plants
SMARTSM007172.8E-10121171IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-11123164IPR009057Homeodomain-like
PfamPF002498.9E-11124167IPR001005SANT/Myb domain
CDDcd001676.37E-11124169No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MAFFRGGSSS SWLAPAPAAP TRRPWTKAED KVFESALVAF PEHTQNRWAL VASHLPGRSA  60
QEVWEHFQVL CSDVDLIERG VVECPGSWDD EFDDEVGAVR AVAQGGAGRG RGGGGGDERR  120
RGVPWTEEEH RLFLEGLEKY GRGDWRNISR WSVKTRTPTQ VASHAQKFFI RQANASSRGD  180
TKRKSIHDIT AP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638220.11e-98PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H71e-48DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0D9WH191e-139A0A0D9WH19_9ORYZ; Uncharacterized protein
STRINGBGIOSGA017964-PA4e-98(Oryza sativa Indica Group)
STRINGLOC_Os05g37060.14e-98(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28953687
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.12e-42MYB family protein